Voltar para notícias
Notícias urgentes/

Apple plans to change its Hide My Email privacy feature that could make it less effective - TechCrunch

Apple plans to change its Hide My Email privacy feature that could make it less effective TechCrunch Apple's New Hide My Email Domain Makes It Easier to Block iCloud Aliases MacRumors Apple since summer they have been changing their emails to iPhone. Does this apply to you too? – LsA magazine Letem světem Applem Apple plans to change iCloud+ privacy features | Gulf Times Gulf Times Sign in with Apple and Hide My Email are getting a new shared email domain 9to5Mac

Foco de busca

appleplanschangeitshideemailprivacyfeaturemakelessapple plansplans change

A YesNo salva esta notícia como um sinal ao vivo no site para conectar a manchete a mercados de previsão e temas em incubação.

Se novas informações criarem prazo, fonte oficial ou resultado verificável, o evento pode virar uma pergunta Yes/No negociável.

Sinal de previsão

Este item tem um ângulo de evento verificável que pode virar uma pergunta Yes/No.

Pontuação
59
Tipo de evento
public_event
Categoria
technology
Sinais relacionados da YesNo

Sinais relacionados ajudam o Google a entender o cluster do evento e levam usuários a temas negociáveis.

US officials say Iran deal calls for diluting uranium at minimum, waiving sanctions, opening strait - AP News

US officials say Iran deal calls for diluting uranium at minimum, waiving sanctions, opening strait AP News US releases official agreement with Iran. Read the 14-point text CNN Iran MOU was signed on Wednesday by Trump and Iran president, U.S. official says Reuters A Look at the Text of the Agreement Between the United States and Iran The New York Times U.S. and Iran sign deal ahead of schedule, sources say Axios

US / officials / say / iran / deal

Mike Krukow delivers impassioned monologue defending SF Giants' Pride Night - SFGATE

Mike Krukow delivers impassioned monologue defending SF Giants' Pride Night SFGATE That Bible verse San Francisco Giants players wrote on Pride caps does not say what they think it does MS NOW Giants pitchers didn’t just deface Pride uniforms. They alienated their fans and city San Francisco Chronicle MLB decries use of personal writings on Pride Night hats ESPN After MLB’s Pride Night warning to Giants players, Sen. Josh Hawley sends letter to Rob Manfred The New York Times

mike / krukow / delivers / impassioned / monologue

Towards autonomous medical artificial intelligence agents - Nature

Towards autonomous medical artificial intelligence agents Nature Agentic AI Comes to Medicine Ground Truths | Eric Topol AI medical tools match or surpass doctors for advice Financial Times New research shows how AMIE, our medical AI, could help manage health conditions. blog.google General-purpose large language models outperform specialized clinical AI tools on medical benchmarks Nature

towards / autonomous / medical / artificial / intelligence

England vs Croatia Quick Highlights | 2026 FIFA World Cup™ - FOX Sports

England vs Croatia Quick Highlights | 2026 FIFA World Cup™ FOX Sports

england / croatia / quick / highlights / 2026

Tyrese Haliburton's Fiancée Speaks Out After Friend Dies at Bachelorette Party - TMZ

Tyrese Haliburton's Fiancée Speaks Out After Friend Dies at Bachelorette Party TMZ Makenzi Kern Obituary June 8, 2026 Hoy- Kilnoski Funeral Home & Crematory Makenzi Kern Dies on Haliburton's Fiancée’s Trip: Family Says No Foul Play Complex Tyrese Haliburton's Fiancée Jade Jones' Friend Dies During Bachelorette Party TMZ Tyrese Haliburton’s bride-to-be shares heartbreaking tribute after her ‘once-in-a-lifetime friend’ dies on bachelorette trip New York Post

tyrese / haliburton / fiancee / speaks / out

Another look at Marcus Rashford's first goal of the 2026 FIFA World Cup™ - FOX Sports

Another look at Marcus Rashford's first goal of the 2026 FIFA World Cup™ FOX Sports

another / look / marcus / rashford / first

Fonte
Google News Technology
appleplanschangeitshideemailprivacyfeaturemakelessapple plansplans changetechnologypublic_eventmainstreamGLOBALGoogle News TechnologyYesNo